Melanoma differentiation-associated protein-like protein

Measure by its ability to induce proliferation in BaF3 cells transfected with human IL-20 R alpha and human IL-20 R beta.
The ED50 for this effect is <1.2 ng/mL.

Interleukin 19 (IL-19) is a protein that in humans is encoded by the IL19 gene. This cytokine is found to be preferentially expressed in monocytes. It can bind the interleukin-20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively, spliced transcript variants encoding the distinct isoforms have been described.

AAK91776

29949

MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA with polyhistidinetag at the C-terminus.

His-tag?at?the?C-terminus

Human

Human

Escherichia coli

E. coli

>98% as determined by SDS-PAGE. Ni-NTA chromatography

<0.1 EU per 1 μg of the protein by the LAL method.

18.69 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa