IL-23, IL-23A, SGRF

Measured by its ability to induce IL-17 secretion in mouse splenocytes.
The ED50 for this effect is <0.5 ng/mL.

IL-23 is an important part of the inflammatory response against infection. It promotes upregulation of the matrix metalloprotease MMP9, increases angiogenesis and reduces CD8+ T-cell infiltration into tumours. IL-23 mediates its effects on both innate and adaptive arms of the immune system that express the IL-23 receptor. Th17 cells represent the most prominent T cell subset that responds to IL-23, although IL-23 has been implicated in inhibiting the development of regulatory T cell development in the intestine. Th17 cells produce IL-17, a proinflammatory cytokine that enhances T cell priming and stimulates the production of other proinflammatory molecules such as IL-1, IL-6, TNF-alpha, NOS-2, and chemokines resulting in inflammation.

Q9NPF7.1

51561

RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP with polyhistidine tag at the N-terminus.

His-tag?at?the?N-terminus

Human

Human

Escherichia coli

E. coli

>95% as determined by SDS-PAGE.
Ni-NTA chromatography.

<0.1 EU per 1 μg of the protein by the LAL method.

19.49 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa