TNFSF1B, Lymphotoxin-alpha (LT-α), LTalpha, Ltx, TNF-be, TNFSF1, Tnf, Tnfb, Tnfsf, Tnfsf1b, Tnlg1e, hlb38, hlb382, lymph

Measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D.
The ED50 for this effect is <30 ng/mL.

TNF-β works as a potential mediator in the inflammatory and immune process. It a component of the TNF family of ligands, and signals through TNFR1 and TNFR2. TNF-β is secreted by activated T and B lymphocytes, and has similar function to TNF-α. In the same manner as TNF-α, TNF-β is involved in the regulation of various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-β is generally released as a soluble polypeptide. In addition, lymphotoxin-β can anchor TNF-β to the cell surface and form heterotrimers in an effective manner. TNF-β is cytotoxic to a wide range of tumor cells.

P09225.1

16992

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus.

His-tag?at?the?N-terminus

Mouse

Mouse

Escherichia coli

E. coli

>98% as determined by SDS-PAGE. Ni-NTA chromatography

<0.1 EU per 1 μg of the protein by the LAL method.

19.36 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa