soluble CD30 Ligand, TNFSF8, CD153, sCD30 Ligand

Measure by its ability to induce IL-8 secretion in human PBMCs.
The ED50 for this effect is <2 ng/mL.

CD30L is a member of the TNF superfamily, and is a type-II membrane-associated glycoprotein. It is primarily expressed on certain B cells, T cells, and monocytes. In lymphomas and various chronically inflamed tissues, CD30L can specifically bind to CD30 (receptor), which is expressed on activated, but not resting, B and T cells. CD30L can interact with CD30 to start a signaling cascade that can finally lead to the activation of NF-κB. CD30L/CD30 signaling applies pleiotropic effects on normal cells, for example: cell death, differentiation, and cell division. CD30L/CD30 signaling can also affect some kinds of diseases, like Hodgkin’s lymphoma, allergic inflammation, diabetes and mycobacterial infection.

P32971

944

MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.

His-tag?at?the?C-terminus

Human

Human

Escherichia coli

E. coli

>98% as determined by SDS-PAGE. Ni-NTA chromatography

<0.01 EU per 1 μg of the protein by the LAL method.

20.57 kDa

The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Blue Ice

Lyophilized protein should be stored at -20°C for 1 year.
Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%
BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months.

Cytokines

Cell culture, Elisa